SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008135 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008135
Domain Number 1 Region: 28-495
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.48e-127
Family L-arabinose binding protein-like 0.00000000000341
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008135
Domain Number - Region: 506-552
Classification Level Classification E-value
Superfamily TNF receptor-like 0.008
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008135   Gene: ENSCPOG00000009056   Transcript: ENSCPOT00000009139
Sequence length 1094
Comment pep:novel scaffold:cavPor3:scaffold_40:5251128:5707163:1 gene:ENSCPOG00000009056 transcript:ENSCPOT00000009139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISA
EEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMRKDYFDY
INVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGN
GGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSVHINKKENLNQTAVIKPFPKSTESRGL
GAGAGRRGGATGPTGGAGAASCAGAGPGGPEPPDAGAKALYDVAEGEEPFAAASVRPRSP
SPISTLSQRAGSGGRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTSLSRANISELQLM
MLSTGAPGPRGGRP
Download sequence
Identical sequences 10141.ENSCPOP00000008135 ENSCPOP00000008135 ENSCPOP00000008135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]