SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008169 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008169
Domain Number 1 Region: 6-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.2e-81
Family Calponin-homology domain, CH-domain 0.000000912
Further Details:      
 
Domain Number 2 Region: 996-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 8.8e-23
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 1103-1263
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-20
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 4 Region: 522-660
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 1213-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 338-447
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-17
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 1519-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000011
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 8 Region: 1628-1772
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000677
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 9 Region: 776-900
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000834
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 10 Region: 1823-1967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000227
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 11 Region: 455-556
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000027
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 12 Region: 2051-2141
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000389
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 13 Region: 1430-1557
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000528
Family Spectrin repeat 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008169
Domain Number - Region: 917-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00177
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1339-1430
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00935
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008169   Gene: ENSCPOG00000009096   Transcript: ENSCPOT00000009179
Sequence length 2146
Comment pep:novel scaffold:cavPor3:scaffold_78:5537740:6506092:-1 gene:ENSCPOG00000009096 transcript:ENSCPOT00000009179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWEEVEDSYEREDVQKKTFTKWINAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALQVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDL
FDWNSVCQQSATQRLEHAFNIAKCQLGIEKLLDPEDVATTCPDKKSILMYITSLFQVLPQ
QVSIEAIQEVEMLPRPSKVTKEEHYELHHQMHYSQQITVSLAQGYEQTTSSSKPRFKSYA
YTQAAYVTTSDPTRSPFPSKHSEAPGDKSFGSSLTETEVNLDSYQTALEEVLSWLLSAED
ALRAQGEISNDVEEVKEQFHTHEGYMMDLTAHQGRVGNVLQLGSQLIGTRKLSEDEEIEV
QEQMNLLNSRWECLRIASMEKQSNLHKVLMDLQNQKLKELNDWLTKTEERTKKMEEEPLG
PDLEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRW
ANICKWTEERWVLLQDILLKWQRFTEEQCLFSTWLSEKEDAMNKIHTTGFKDQNEMLSSL
QKMAILKADLEKKKQTMDKLSSLSQDLLSTLKNKSVTQKIEAWMENFAQRWDNLFQKLEK
SSAQISQTVTTTQPSLTQTTVMETVTMVTTREQILIKHAQEELPPPPPQKKRQIIVDSEI
RKRLDVDITELHSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKSRKLQDA
SRTAQALVEQMVNEGVNGDSIRQASEQLNSRWTEFCQLLSERLNWLEYQNRIITFYNQLQ
QLEQMTTTAENWFKTQPTSTSDPTALKSQLKICKDEVKRMSALQSQIERLKIQSIALKEE
GKGPMFLDADFVAFTNHFNQVFADMQAKEKELQTICDSLPPVHYQETMSTIRTWIQQSET
KLSIPQLSVTEYEIMEQRLGELQALQSSLQEQQTGLNYLSTTVKEMSKKAPSEISRKYQS
EFEEIDERWKKVSSQLLEHCQKLDEQMNKLRKIQNHIKTLKKWMAEVDVFLKEEWPALGD
SEILKKQLKQCRLLVNDIQTIQPSLNSVNEGGQKIKSEAEPEFASRLDTELKELNAQWEN
MCRQVYARKEALKGGLDKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQSAVEEM
KRAKEEAQQKETKVQLLTETVNSVIAQAPPAAQEALKKELDTLTTNYQWLCTRLNGKCKT
LEEVWACWHELLSYLEKANKWLNEVELKLKTTESIPGGAEEISEVLESLENLMRHSEDNP
NQIRILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLH
LIQESLESIDKQLATYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKRNQGKDAAQRV
LSQIDIAQKKLQDVSLKFRLFQKPANFEQRLEESKMILDEVKTHLPALETKSIEQEVVQS
QLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVT
ERKQQLEKCLKLSRKMRKEMNVVTEWLAATDMELTKRSAVEGMPCNLDSEVAWGKAIQKE
VEKQKVHLKSVTEIGEALKAVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYRRH
MDTFDQNVDHITKWINQADALLDESEKKKGQYKEDILKRLKAEMNDIRPKVESTRDQAAN
LMANRGNHCRKLVEPKISELNHRFAALSHRIKTGKASIPLKELEQFNSDIQKLLEPLEAE
IQQGVNLKEEDFNKDMSEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNA
LKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQ
KKKEELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTLHEE
TMRVMTEDMPSEISYVPSAYMTEITHVSQALSEVEQILNAPELCAKDFEDLFKQEESLKN
IKDNLQQISGRIDLIHSKKMAALQSASPAERPKLQEALSQLDFQWEKVNKLYKDQQGRFD
RSVEKWRRFHYDMKIFNQWLTEAEQFFKKTQIPENWEHAKYKWYLK
Download sequence
Identical sequences ENSCPOP00000008169 ENSCPOP00000008169 10141.ENSCPOP00000008169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]