SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008252 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008252
Domain Number 1 Region: 85-147
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000236
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008252   Gene: ENSCPOG00000009191   Transcript: ENSCPOT00000009274
Sequence length 502
Comment pep:novel scaffold:cavPor3:scaffold_25:22332619:22368846:-1 gene:ENSCPOG00000009191 transcript:ENSCPOT00000009274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQALSPSTAFLSMQLSQAGPEDRALAPTCTGDPSRYYDRATGQCCYRCLPGSLPAQSCPQ
GPSDCRKKQCDPEHYVDESGYCLACVSCFGDLVEKVPCSWNSSRMCECRPGMFCKTSAAY
SCARCQPHSPCSEGKVITALGTAERDTVCDWPSPGTSLDCASPEACRIPTRGATRQAKPT
EVSPATADARTPPQGGDTPPRLEDAPQLVSAPGDQGRKILEHGCAPGVVGGDTTLEPPAL
ETHPGYSPPANSKAPASTRPTQSPLMGSPTSLGPPVSTSTRGSLPSTGRPILDPGPVLFW
VIMVLAVVLGSGSFVLCYRRACRARIRQKLHLCYPTQTVRPGLEPAASCPVLPPTQVPRQ
GSSLEEPLGHHVLVPESPPPVVETCANVGAASPENLLLLDASPAGDEVSPRDPPEPRVST
EHTNNRIEKIYIMKADTVIVGSVKTELPEGRGPAVPELETDLEVDQASHYPEQETEPPLD
SCGDVMFSVEEEGKEDPWLSAK
Download sequence
Identical sequences ENSCPOP00000008252 10141.ENSCPOP00000008252 ENSCPOP00000008252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]