SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008257 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008257
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.98e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.71e-20
Family Anticodon-binding domain of Class II aaRS 0.0056
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000169
Family a tRNA synthase domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008257   Gene: ENSCPOG00000009197   Transcript: ENSCPOT00000009280
Sequence length 509
Comment pep:known scaffold:cavPor3:scaffold_6:2972705:2984822:-1 gene:ENSCPOG00000009197 transcript:ENSCPOT00000009280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANCASLEELVRLQGEHVRSLKQQKANAEQIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILGSLQIGDFLVKVNDRRILDGMFAICGVPDSKFRTICSSVDK
LDKVSWEDVKNEMVGEKGLDPEVADRIGDYVQKHGGVSLVEQLLQDPKLSQNKQALGGLG
DLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VASREEVDVRREDLVEEIRRRTSQPLCIC
Download sequence
Identical sequences H0VE29
XP_003477247.1.53824 ENSCPOP00000008257 10141.ENSCPOP00000008257 ENSCPOP00000008257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]