SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008265 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008265
Domain Number 1 Region: 56-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000261
Further Details:      
 
Domain Number 2 Region: 407-501
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.02e-19
Family Anticodon-binding domain of Class II aaRS 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008265   Gene: ENSCPOG00000009203   Transcript: ENSCPOT00000009288
Sequence length 505
Comment pep:known scaffold:cavPor3:scaffold_6:2985119:2991621:1 gene:ENSCPOG00000009203 transcript:ENSCPOT00000009288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLGFLPRRACAALLSQMLRPPRAACLPAVCCHSQVAEVMLTSQLKPHQEKPNFIIKTP
KGTRDLSPQQMVVREKILDMVISCFKRHGAQGLDTPAFELKETLTEKYNEQSGLIYDLED
QGGELLSLRYDLTVPFARYLAMNKLKKMKRYQVGKVWRRESPTIVQGRYREFYQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGIFAVCGVPESKFRTICASMD
KLDKISWKDVRHEMVAKKGLAPEVADRIGDYVQHHGGISLVEQMLQDPRLSQSEQALEGL
KSLKLLFEYLTLFRITEKISFDLSLARGLDYYTGVIYEAVLLQPPAAGEEPLHVGSVAAG
GRYDELVAMFNPKGHKVPCVGLSIGVERIFHIVEQRMKTFGEKVRTTETQVFVATPQKNF
LQERLKLIAELWDAGIKAEMLYKNDPKLLTQLHYCENTGIPLVVIIGEQEQQEGVIKLRS
VATREEEVIKREHLVAEIQRRVSQP
Download sequence
Identical sequences ENSCPOP00000008265 10141.ENSCPOP00000008265 ENSCPOP00000008265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]