SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008287 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008287
Domain Number 1 Region: 42-97
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000118
Family TNF receptor-like 0.00018
Further Details:      
 
Domain Number 2 Region: 99-144
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000314
Family TNF receptor-like 0.0016
Further Details:      
 
Domain Number 3 Region: 141-179
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000114
Family TNF receptor-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008287   Gene: ENSCPOG00000009228   Transcript: ENSCPOT00000009313
Sequence length 282
Comment pep:known scaffold:cavPor3:scaffold_186:304703:309062:-1 gene:ENSCPOG00000009228 transcript:ENSCPOT00000009313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALPGWGRPYWHPGPEANTLRLALCLLLLGSPQHTPAQPACRQEEFPVGLECCPKCGPG
FHVRRVCSELTGTECSPCPAGTYTAHPNGLRQCLHCQACEPGMGLVTRRKCSSTQDTVCD
CIQGHFCKAQEGDHCVLCEPHSTCLAGQRVKERGTSSQDTLCADCPPGTFSPNGTLDQCL
PWTRCSWFQREVEPSTSSEDVTCSLSGLISGLCVTFFLLGLSLVIWIWKKRKRSLGFGAS
MTSAAQGQKWGGAEEPEVTEVLQACPDVTTVAVEETAMCRES
Download sequence
Identical sequences ENSCPOP00000008287 10141.ENSCPOP00000008287 ENSCPOP00000008287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]