SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008306 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008306
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-90
Family Calponin-homology domain, CH-domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 2312-2428
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-30
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 1516-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 1.75e-29
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 1837-1993
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-22
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 806-937
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-22
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1729-1880
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-21
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 9 Region: 1201-1353
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-20
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 10 Region: 537-643
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-18
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 11 Region: 986-1108
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-16
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 12 Region: 730-836
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000128
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 604-709
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000095
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 14 Region: 1117-1216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000445
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 1353-1466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000245
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 16 Region: 1995-2057
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000317
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008306   Gene: ENSCPOG00000009252   Transcript: ENSCPOT00000009337
Sequence length 2467
Comment pep:novel scaffold:cavPor3:scaffold_157:495638:566942:1 gene:ENSCPOG00000009252 transcript:ENSCPOT00000009337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVPGEVDNVEGLPAPNNNNLVARWDSPDRGWEREPPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIADLYSDLRDGFVLTRLLEVLSGEQLPKPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLAKSNANY
NLQKAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIERYEELAAELLAWIHRTIALISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGQLEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVVMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADTA
AYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGARRSRLEQNLALQK
VFQEMVYMVDWMEEMQAQLLSRECGQHLVEVDDLLQKHGLLEADISAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESW
ARDKERLLHDLSSTARLLAQHKILQGELGGRRALLQQALRRGEELTAAGGSVGAGAETMQ
LAGLAERAALHQFGADLDALLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAH
RGPVGGLRRQLAALGGASGAGPLVVTLQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYR
MFGEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQ
ELVKGGHPSSDEVRSCQDHLNSRWNCIVELVEQRKEEMTAVLLVENHVLEVAEVRAQVRE
KRRAVELQWRLSGLEAALQALEPRQAALLEEAELLAARFPTQATRLQQGAQELGAEWGAL
ANAAQACGEALAAAGRLQRFLHDLDAFLDWLVRAQEAAGGSQGPLPGSLEEADALLARHA
ALKEEVDQREEDYTRIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARRE
ALVQAHVYQLFLRDLCQALAVLHNQEVALSGAELPGTMESVEEAIKRHRDFLTTMELNQQ
KMQVAVQAAEALLRQGNAYGEQAQEAVARLLEKSQENQLRAHQWMQKLHDQLGLQHFLRD
CHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQE
KPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQL
QDVDPGGDLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQSAV
GERLVRLLEPLQERRRLLLASKELHQVAHDLEDELAWVQERLPLAMQTERGSSLQAVQQH
IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR
QQSLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENY
EESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLS
RQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDE
LIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEK
RRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAI
ASREQEVLQGWKELLSACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRD
VSSVEVLMNYHQGLKTELEARLPELTACQELGRSLLLNKSAMADEIQAQLDKLATRKEEV
SDKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAF
RKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGASSSVPTELAAKAAPLLRPGGYE
RGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEVPARAEPVSPPTAPEDA
VETPGTPVVVEQVRPAEHEAAHSLTLGRYEQMERRRERRERRLERQESSEQETPRGELIK
GKATLADIVEQLQEKEAGPGLPAGVPSLPQPRELPPGRLPNGFEPPERTPRPDRPRARDR
PKPRRRPRPREGGEGGVSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKS
SNRSWVSLYCVLSKGELGFYKDAKGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKL
QTQDGSEFLLQAKDEEEMNGWLEAVAASVAEHTEIARWGQTLPTTSSTDEGNPKREEGER
RASGRRK
Download sequence
Identical sequences 10141.ENSCPOP00000008306 ENSCPOP00000008306 ENSCPOP00000008306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]