SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008390 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008390
Domain Number 1 Region: 116-208
Classification Level Classification E-value
Superfamily PKD domain 0.000000000576
Family PKD domain 0.0074
Further Details:      
 
Domain Number 2 Region: 217-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008390
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily Gated mechanosensitive channel 0.0798
Family Gated mechanosensitive channel 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008390   Gene: ENSCPOG00000009348   Transcript: ENSCPOT00000009433
Sequence length 408
Comment pep:known scaffold:cavPor3:scaffold_60:539719:589970:1 gene:ENSCPOG00000009348 transcript:ENSCPOT00000009433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPGARAGYSALPDAIIRNKDSLAAGASFLRAPAAVRDWRQCVAACCAEPRCSVAVVELPP
RPAGPAATLGCFLFNCTARGRSVCKFAPHRGYRSYRLRRTPDAEISGLIYKPTQDAPPLS
KAGQDVVLHLPTDEVILDGRESSDDHAIIQYEWTLLQGDPSVSMKVPQPGTLKLSHLQEG
TYTLQLTVTDTAGQKSTDNVSVTVHPRPAPPGGCMNICSRYHFFCDNGCCIDIALTCDGV
RQCPDGSDEDFCQNLGLDRKLVTHTATSPAQPGPTGLITDTRKDLHLEKSQKTTPPNLPA
TLPSTEKRNHSTLGRPESQSGLMMPDGSSSGKNRNEESFNLESKSHRGRGEHPAPEAGAV
LPLALGLAITALLLFMVACRLRLVKQKLKKARPITSEESDYLINGMYL
Download sequence
Identical sequences 10141.ENSCPOP00000008390 ENSCPOP00000008390 ENSCPOP00000008390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]