SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008430 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008430
Domain Number 1 Region: 12-372
Classification Level Classification E-value
Superfamily Sialidases 7.57e-106
Family Sialidases (neuraminidases) 0.000000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008430   Gene: ENSCPOG00000009389   Transcript: ENSCPOT00000009474
Sequence length 379
Comment pep:known scaffold:cavPor3:scaffold_13:28862969:28865100:-1 gene:ENSCPOG00000009389 transcript:ENSCPOT00000009474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSQILQRERLFQSGTHTYRIPALLYLRGQNTLLAFVEQRQSKKDEHSELIVLRRGVYN
ASSHQVTWQAQEVVARAQLQGHRSMNPCPLYDEQTGTLFLFFIAVLGQVSENHQLQTGVN
VTRLCQVISMDHGRTWSPARDITEVAVGQAHREWATFAVGPGHCLQLHNRAGTLVLPAYA
YRLRPRPLPPLPSAFCFLSHDHGRTWTRSGFVGQKTLECQVAEIGTEGHRVLYLNARSPQ
KARVQAQSTNDGLDFSVSPSVRQLVEPPSGCQGSVVSFPGSRQGPGATGQWLLYSHPTDP
GKRSNLGIYLNQQPLEPTAWAGPALLASGSCAYSDLQSMGPGPDGSPQFGCLYEAKDYQE
VVFLMFTLKQVFPASSWTP
Download sequence
Identical sequences 10141.ENSCPOP00000008430 ENSCPOP00000008430 ENSCPOP00000008430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]