SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008517 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008517
Domain Number 1 Region: 645-754
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000005
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 372-491
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000078
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 
Domain Number 3 Region: 877-982
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000892
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008517
Domain Number - Region: 89-195
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0202
Family Regulator of G-protein signaling, RGS 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008517   Gene: ENSCPOG00000009489   Transcript: ENSCPOT00000009575
Sequence length 1078
Comment pep:novel scaffold:cavPor3:scaffold_12:2369203:2434747:-1 gene:ENSCPOG00000009489 transcript:ENSCPOT00000009575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPHIEIIGSTNLIILLENEIFADFFNTFLSLPVFGQTPSYTVENSQWTLWPELPYNLISK
YKGLLTWLEKYRLPFFCKTNLCLHYILCQELVTFARSPEGGEELVDFWILAEKILSIDEM
DLEVRNYYLSLLLVLKATHLQEGSRVVTLCNTNIKSLLNLSLWHPTQSPTRRETLSHMQK
VALFKLQSYWLPNFYAHAKMAIATKSTCHALMQEYQTRLCSFCYTHVERLPLNMSIQKSL
HSHKQYSSKKAKRKIWQLTDHSSWSVEFDFMPDVSTSQVARPPEKVVIQMPSLEEASSKE
RMIRPQEEDSHCVKKSSIKKKSNSHLQMDGLFETKLSTHLRTSTPIINHSSQMTIKKVIK
QSFSLVYTHWALCADTCAGSPFRDYLKKMNLKVEIQLLDLWQDLYHFLGVLMNSRKNGNA
LFRHLLGDRICELYLNEKIDPHLPLKSQIIQGLKEMLPSGDANPWIPKAQREICKMLSPW
YDKFLDEEDYWFLVFTTQTQFLKSRRHKKESTDKKYNILICKRIQESLKLSQALANMEEM
ECIQWEKIATENLRQGGSLQVELTSPVFLEDINKMTFEELCLKNPKLAIEKISDDYKKYC
ERAPKEDFSVEIYITARSLKSASRAEKKISFFKKVGVRKPSVRPRNMAEIFLNTQHLQFF
REFLKQRKAETPLQFLIAVHKLSKELMELEFKEVVEGKDGLFTLSCVFLEEMLQCNAPII
KEVVDMQQVSTTTLLILQSYVTKSLEEKWLKEYQELFPPLPPPPLEVEIEVPTSQKKPSK
TAVNRQEFKKRGWLKMICFIRSFCNYRRFTSNPMKCQEFIDYLHLEMHNKENFSSSPTVS
GRQTSQSPNVRVSEQEKEEITLVKRRIYGQRTIVINFAVNDLYFFSEMEKFNALVSSAQL
LQANRTFNENDLVLMQAKINIILRLFLHAEVPPRLRVNISEAQKDAILTSIAEGHLDWNM
FHGAIISVFPVIMYFWRRFCSWKATHAYLQFVGKKVKDRKISPKPINKTPPVSSGDHNVL
RFSLLRGIEWLRSQQKEVPSSPLPNSSSSNLTPTRTALSAIQLYPAWGPKLSHTKKER
Download sequence
Identical sequences 10141.ENSCPOP00000008517 ENSCPOP00000008517 ENSCPOP00000008517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]