SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008589 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008589
Domain Number 1 Region: 296-442
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-24
Family Regulator of G-protein signaling, RGS 0.0028
Further Details:      
 
Domain Number 2 Region: 481-601
Classification Level Classification E-value
Superfamily PX domain 4.45e-24
Family PX domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008589   Gene: ENSCPOG00000009570   Transcript: ENSCPOT00000009656
Sequence length 881
Comment pep:known scaffold:cavPor3:scaffold_31:4189153:4282233:1 gene:ENSCPOG00000009570 transcript:ENSCPOT00000009656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQ
ALQNALIQFATRAKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRITEKDDQMKGTAEDLID
SFFEVEVEMEKEVCRDLVCTSSKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILA
RGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNVGELEAVRDKAAEELQ
YLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTVKLAANFGKLCTVPLD
SILVDNIALQFFMDYMQQTGGQAHLFFWLTVEGYRVTAHQQLEVLLSRQRDGKHQTNQTK
GLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYDLMLR
DERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSSVSS
DDSVQLHAYISDTGVCNDHGKTYALYAITVHRRNLNTEEMWKTYRRYSDFHDFHMRITEQ
FENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKACPALAHCVYDFLEN
KAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQD
IKQSFFKVPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRN
IKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGISAETVPCRDK
AIRMRTRIAGKTKLFAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFL
ETLFPQYKFRELFNKLHSGSKQMLKYKQKLQTTQAPSLQKR
Download sequence
Identical sequences ENSCPOP00000008589 ENSCPOP00000008589 10141.ENSCPOP00000008589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]