SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008633 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008633
Domain Number 1 Region: 226-479
Classification Level Classification E-value
Superfamily Caspase-like 5.08e-86
Family Caspase catalytic domain 0.0000000245
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily DEATH domain 1.37e-31
Family DEATH effector domain, DED 0.0035
Further Details:      
 
Domain Number 3 Region: 99-190,224-254
Classification Level Classification E-value
Superfamily DEATH domain 9.03e-26
Family DEATH effector domain, DED 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008633   Gene: ENSCPOG00000009618   Transcript: ENSCPOT00000009705
Sequence length 481
Comment pep:known scaffold:cavPor3:scaffold_104:579696:591792:-1 gene:ENSCPOG00000009618 transcript:ENSCPOT00000009705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSFHVLLYNIGEQLDSEELASLKFLSHDHIPQRKQEPILDPCMLFQRLQEKRVLEEGNLS
FLKELLFRINRLDLLGTYMNTSREELERELQTPGKAQISAYRVMLFRIAEDVNKSELRSF
KFLLYKEISKSKLDDNMSLLEIFTEMEKRAILGKDNLDTLKQICAQVNRSLLRKIGEYEE
QLGERRMSLGQSPDAFSKLVEELPFEMQDALDSLEGQNSKAQMLDQIYQMKSKPRGYCLI
FNNYDFSEARKNIPKLSKMKDRKGTDFDAETLGSTFSELHFETVLCRDLTAQAIRETLQY
YQGVDHSDRDCFVCCVLSHGNRGIVYGINGQEVSISELTSYFTGSKCPSLAGKPKVFFIQ
ACQGENFQKAISVETDSDKNKVSAEDDFSYTWLTIPDNGDFLLGMATVDSYVSYRDPTKG
TWYIQTLCDSLRRRCPCGDDILTILTEVNFKVGEKIDLKNRGKQMPQPMFSLRKKLFFPT
D
Download sequence
Identical sequences ENSCPOP00000008633 10141.ENSCPOP00000008633 ENSCPOP00000008633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]