SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008740 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008740
Domain Number 1 Region: 165-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.17e-48
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 1765-1831
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-19
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 621-717
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-19
Family PDZ domain 0.0000099
Further Details:      
 
Domain Number 4 Region: 515-589
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008740   Gene: ENSCPOG00000009737   Transcript: ENSCPOT00000009824
Sequence length 1833
Comment pep:known scaffold:cavPor3:scaffold_42:10228030:10659677:-1 gene:ENSCPOG00000009737 transcript:ENSCPOT00000009824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPTSSEDEMAQSFSDYSMGSESDSSKEETIYDTIRATAEKPGGVRMEESQGDTLVIR
VVIQDLQQTKCIRFNPDATVWVAKQRILCTLNQGLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPTGPGVPSLEFRYKKRVYKQSNLDEKQLAKLHTKTNLKKFMDHTQHRSVEKLV
KLLDRGLDPNFHDLETGETPLTLAAQLDDSMEVIKALRNGGAHLDFRAKDGMTALHKAAR
ARNQIALKTLLELGASPDYKDSYGLTPLYHTAIVGGDPYCCELLLHEHATVCCKDENGWH
EIHQACRYGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQDSCARVLLFRGGNKELK
NYNSQTPFQVAIIAGNFELAEYIKNHKETDIVPFREAPAYSNRRRRPPNTLAAPRVLLRS
NSDNNLHAGAPEWAVCSAATAHRSLSPQLLQQVPSKPDGTVKSIPSYVPGPRSRSPSLNR
LGGTGEDGKRPQPHWHVGPPLTPGANKGSLSAFEYPGPKRKLYSAVPGRLFVVVKPYQPQ
VDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPADCVEEVQCKPKDGQAETRADRSK
KLFRHYTVGSYDSLDASGDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFP
ALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLILKVVTVT
RNLDPDDTARKKAPPPPKRAPTTALTLRSKSMTAELEELVDKDKPEEIVPAPKPSRTAEN
VAVESRVATIKQRPTSRCFPAVSDMNSVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQ
KSIDSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYN
CPKSPTPRVYGTIKPAFNPNSAAKVSPATRSDTVATMMREKGMFYRRELDRYSLDSEDLY
SRNAPPQATFRTKRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVEDSPEKTC
SIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQVTEPPGQLRPDDSLTVSSPFAAAIAGAVR
DREKRLEARRNSPAFLSTDLGDEDVGLGPPIPRVRPSKFPEEGGFGDEDGSEQLVSPTPG
ASPREPENHFMGSGEAGAQAEAGRPLNSASKAKGPEGSTAAPPKSSSTASPENYVHPLTG
RLLDPSSPLALALSARDRALKESQQGPKGEAPKADLNKPLYIDTKMRPSVEAGFPPVTRQ
NTRGPLRRQETENKYELDLSKDRRGEDKKNMLINIVDTAQQKTAGLLMVHTVDATKTGGP
LEEEEEREDVDIKPDNLPSTVPEGVSETEGALQISAAPEPTTTPGRTIVAAGSMEEAVVL
PFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRAASVPALTDLAKQKKSDTPP
SPSWNAGQPASSTDSKKPASLSNCLPTSFLPPPESFDAVTDSGIEEVDSRSSSDHHLETT
STISTVSSISTLSSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIIHKSNALYQDAL
LEEDVDSFVPGSTQPGMAKVIQPRTSKLWGDVTEVKSPILSGPKANVISELNSILQQMNR
EKSAKPGEGLDSPAGAKSASLPPRSLEVMSTVSGTRSTTVTFTVRPGTSQPITLQSRPPD
YESRTSGTRRAPSPVVSPTEMNKEILPTPLSAAAASPSPTLSDVFSLPSQSPAGDLFGLN
PAGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFMDNEIDGSH
LPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
Download sequence
Identical sequences 10141.ENSCPOP00000008740 ENSCPOP00000008740 ENSCPOP00000008740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]