SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008771 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008771
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 2.71e-24
Family Pyrin domain, PYD 0.0024
Further Details:      
 
Domain Number 2 Region: 439-502
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.85e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008771   Gene: ENSCPOG00000009769   Transcript: ENSCPOT00000009857
Sequence length 653
Comment pep:novel scaffold:cavPor3:scaffold_4:23287205:23297847:-1 gene:ENSCPOG00000009769 transcript:ENSCPOT00000009857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNLSDHLLNTLEELVPYDFEKFKFKLQNTGMEKGHTRIPRGQLQMARPVKLATLLITH
YGEEYAVQLTLQVLRSINQRLLAEELHRATGQAHQSERESCTDTLAPSSGENKSKSLKVP
NDPAGDGQRQSAEGAVSLLSSQTEAVRGPQKKSLGKRRDPKGPEGLDAQGKLLGRSTVLP
ARRSPVPTQQQPGNLEIQRSIKLRRNASSAGRLQGLSSGALGKRDCKKSEVYLPSGKQRP
KSLEFTISSEKEEPSNPETLLTSLEEMRNTNVHSAAISRGAASVALENGSRNAERFGVME
EGAFKITLSSACLATDEKSTASTEEYGTGHPDTEGKIAGSVFHKSSNPEELRINLREVVL
SGKEKPASLSYSMSPGRPQDEAACPQCRSQEGDLLGGTCVHGSDSCLVASGDSKTSGNSF
PSFLKCQALLARKSSGDMSPQALPQCQRHMKQARLLFCEDHGELICLICRLSQEHQGHQV
RPIEEAALDYKEQIQKKLEYLKELRKSGEEQRSQGDMKTAHFLKQTETQKQRVQYQLEQL
CQFLKQQEQVFLAWLEELSQTIGRVQKTYGTQMSQHIALLDERIGELEAKQGQSEWELMQ
DIRVTLNRTKIMTVPEPWTTPPEVKDKIHLLHQKSEIVEKSMKYFSDTLRSEM
Download sequence
Identical sequences ENSCPOP00000008771 ENSCPOP00000008771 10141.ENSCPOP00000008771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]