SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008791 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008791
Domain Number 1 Region: 150-486
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-86
Family Protein kinases, catalytic subunit 0.0000000000116
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-39
Family Regulator of G-protein signaling, RGS 0.000000548
Further Details:      
 
Domain Number 3 Region: 517-625
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-22
Family Pleckstrin-homology domain (PH domain) 0.00000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008791   Gene: ENSCPOG00000009793   Transcript: ENSCPOT00000009881
Sequence length 651
Comment pep:known scaffold:cavPor3:scaffold_4:17526783:17634468:1 gene:ENSCPOG00000009793 transcript:ENSCPOT00000009881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIRSVMQKYLEERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDS
DNDRLCRSRQIYDAYIMKELLSNSHPFSKQAVEHVQSHLSKRQATSTLFQPYIEEICESL
RGNIFQKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMY
AMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGG
DLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLG
LACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTK
DKHEIDRMTLTVNVELPDAFSPQLRSLLEGLLQREVGKRLGCHGGGAQEVKEHSFFKGID
WQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYRNFPLVISERW
QQEVTETVYEAVNTDTDKIEARKRAKNKQLGHEEDYALGKDCIMHGHMLKLGNPFLTQWQ
RRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFILQCESD
PEFAQWKKELTETFTEAQRLLRRAPKFLNKARSGVVELSKPPLCHRNSNGL
Download sequence
Identical sequences 10141.ENSCPOP00000008791 ENSCPOP00000008791 ENSCPOP00000008791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]