SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008937 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000008937
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily DEATH domain 0.00288
Family Caspase recruitment domain, CARD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008937   Gene: ENSCPOG00000009958   Transcript: ENSCPOT00000010048
Sequence length 778
Comment pep:known scaffold:cavPor3:scaffold_8:24194708:24220794:-1 gene:ENSCPOG00000009958 transcript:ENSCPOT00000010048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQQL
SPQLTVHQPAEQPIQVQVQIQGQTPQSAASSIQTPSLQSPNPSQLQAAQIQVQHVQAAQQ
IQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTA
SVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATG
TITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKE
KMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQ
QQPQQQTPQEQTPPPPQQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEEG
LEVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARNG
EGEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGYV
LPSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKNP
SNPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLFKCPQSVK
GRNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQETIAVASASTMH
Download sequence
Identical sequences H0VFS6
XP_003476709.1.53824 XP_005006686.1.53824 XP_005006688.1.53824 XP_013015232.1.53824 XP_013015233.1.53824 XP_013015234.1.53824 ENSCPOP00000008937 ENSCPOP00000008937 10141.ENSCPOP00000008937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]