SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008970 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008970
Domain Number 1 Region: 32-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.31e-92
Family L-arabinose binding protein-like 0.0000668
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008970
Domain Number - Region: 493-539
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00471
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008970   Gene: ENSCPOG00000009995   Transcript: ENSCPOT00000010085
Sequence length 820
Comment pep:known scaffold:cavPor3:scaffold_25:26120795:26128721:-1 gene:ENSCPOG00000009995 transcript:ENSCPOT00000010085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVPRVTHLLCLLLTLTCCRALSCREPASSPDFTLPGDYLLAGLFPLHSDCLYVRRRPQVT
LCDRPDSFNGHGYHLFQAMRFSVEQINNSTALLPNVSLGYELYDTCSDSATVYAVLHALA
QQGTNHVEIQENLYRYSPKVVAFIGPDDTEDSATAAALLSPFLVPLISYQASSTVLTAKR
LYPSFLRTVPSDRYQVETLVLLLQRFGWVWISLVGSFGDYGEQGVQSLEELTTERGICVA
YKGIVPFSAHVGDAAMQSMMYSLARARTTVVVVFAIRRLARVFFGSVMLANLTGKVWIAS
EDWAISTHISGMSGIRGIGMVLGVTIQHRSIPGLEEFEEAYARADKGAPRPCPRGSWCST
NQLCRECQAFTAHRMPLLGPFSMASAYEVYRAVYAVAHGLHQLLGCASGSCSRGRVYPWQ
LLEQIYKVNFLLHEDTVTFDKNGNSFSNYNIIAWDWSGPNWTFRVIGSSTWPPVQLDINK
TNIPWHGKDNQVPSSVCTEDCTEGHHRVVWGFFHCCFQCVPCEAGTFLNKSDLYHCQPCG
REEWSPEASHTCFPRIVLVLTWHEPISLVLLAANTPVVRSAGGRLCFLMLGSLTAGSCSL
YSFFGEPTLSACLLRQALFPLSLTIFLSCLTIRSFQLVIIFKCATKVPTSYYAWARNHGA
GQFVMLSSMAQLLICLISLAVWTPLPTREYQRFPQLVVLECTETNSPGFLLAYIYIGLLS
VSSFACSYLGKDLPENYNEAKCVTFSLLLSFVSWITFYTMCSIYQGQYLSAINVLVRLTT
LSGGFSGYFLPKCYVILCRPDLNNTEHFQASIQDYTRRCG
Download sequence
Identical sequences 10141.ENSCPOP00000008970 ENSCPOP00000008970 ENSCPOP00000008970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]