SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009027 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009027
Domain Number 1 Region: 753-1024
Classification Level Classification E-value
Superfamily RNI-like 9.81e-58
Family 28-residue LRR 0.0052
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily DEATH domain 5.65e-16
Family Caspase recruitment domain, CARD 0.0029
Further Details:      
 
Domain Number 3 Region: 104-182
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000372
Family Caspase recruitment domain, CARD 0.0078
Further Details:      
 
Domain Number 4 Region: 285-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000123
Family G proteins 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009027   Gene: ENSCPOG00000010054   Transcript: ENSCPOT00000010145
Sequence length 1031
Comment pep:novel scaffold:cavPor3:scaffold_5:8919895:8946994:1 gene:ENSCPOG00000010054 transcript:ENSCPOT00000010145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQEAFQAQRSQLVGLLVSGSLEGFESILDWLLSWEVLSWEEYEGLRLPSQPLSHAARH
LLDMVWNKGSWSCQKFLEAVQEAQTDSQPPELHDSWDSHSCHPVQDLQRHRPAIVRRLYS
HVENVLAVVRERGFISQYECDEIRLPIFTASQRARRLLDLATVKANGLAAFLLQYIEESP
ASLSLPFEGMYLFFSGKGNKHTHHYLFCLTAAECQRYISKLRTTVSAQSRSLSTYDGVEN
LCLEDIYTENILELRTEVGSLKKSPSTLGLEELFSTQGHLNEDADTVLVVGEAGSGKSTL
LQRLHLLWATGRDFQEFLFVFPFSCRQLQCVTKPLSVRTLLFEHCCWPDVGQQDVFQFLL
DHPDCVLLTFDGFDEFRFKFTDQVRHCSPADPTSVQTLLFNLLQGNLLKNARKVLTSRPD
AVSACLRKYIRTECHLRGFSEEGIELYLRKCHHEPGVADRLIHLLRATSVLYGLCHLPVF
SWMVSKCHQELLLQNGGSPQTSTDMYLLILQHFLLHASPPEAVSRGLVPGLLRSKLPSLL
HLGRLAFWGLGRCCYVFSAQQLQKAQVDPEDISLGFLVRAQGVVPGSTAPLEFLHITFQC
FFAAFYLVLCVDVPKASLRHLFKCRRPGSSPLTRLLPVLCVQSSRIKEGSVAALLQKIEP
HNLHLTAAFLAGLLSQEHQDLLAECQASEKALLQRHACARWCLARSLRKHFHCIPPAVPG
EAKSMHAMPGFVSLIRSLYEMQEEQLAREAVRGLDIGHLKLTFCSVGPAECAALAFVLRH
LQQPVALQLDHNSVGDIGVEQLLPCIGICKALYLRDNNISDRGICKLIEHALHYGQLQKL
ALFNNKLTDGCAHAMAKLLECNQNFLALRLGNNHITAAGAQVLAQGLRRNASLQFLGFWG
NTVGDEGAQALAEALGDHQSLKWLSLVGNSIGSMGAQALAQMLEKNVALEELCLEENHLC
DEGVCSLAEGLKRNSSLKVLKLSNNSVTSRGVEALLQALESNNTILEVWLRGNTFSSEEI
EKLGHRDTRLL
Download sequence
Identical sequences ENSCPOP00000009027 ENSCPOP00000009027 10141.ENSCPOP00000009027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]