SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009088 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009088
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 227-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000382
Family Fibronectin type I module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009088   Gene: ENSCPOG00000010120   Transcript: ENSCPOT00000010211
Sequence length 381
Comment pep:known scaffold:cavPor3:scaffold_2:50774584:50776678:-1 gene:ENSCPOG00000010120 transcript:ENSCPOT00000010211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSRTAQALAVTVTLLHLVRLALSTCPTACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIALCPQELSLPNLGCPNSRLVKVTGQCCEEWVCDEDGVKDSMDDQDGLLG
KGLGFDASEVELTRNNELIAVGKGGSLKRLPVFGIDPRILYNPLHGQKCIVQTTSWSQCS
KTCGTGISTRVTNDNAECRLVKETRICEVRPCGQPLYSSLKKGKKCSKTKKSPEPVRFTY
AGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGETFSKNVMMIQSCRCNFNCP
HANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences H0VG66
ENSCPOP00000009088 10141.ENSCPOP00000009088 XP_003478844.1.53824 ENSCPOP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]