SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009089 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009089
Domain Number 1 Region: 304-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-25
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 
Domain Number 2 Region: 515-648
Classification Level Classification E-value
Superfamily PX domain 2.49e-21
Family PX domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009089   Gene: ENSCPOG00000010122   Transcript: ENSCPOT00000010213
Sequence length 862
Comment pep:known scaffold:cavPor3:scaffold_36:8961862:9057793:-1 gene:ENSCPOG00000010122 transcript:ENSCPOT00000010213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQNPVCGNSHEAVQSRRVVISHNVDKALKEVFDYCYRDYVFSWYGNLSKDEGQLYHLLLE
DFWEIVKQLHHRMNHVDVVKVVCHEVVRALLTHFCDLKAANPRHEEQPRPFVLHSCLRNS
EEELKFLQMCSQVLVFCFLPSKDVHSLSLRIMLAEILTTKVLKTVVDFLSNPDYINQMLL
SQLEYREQMNEHHKRAYTYAPSYEEFIKLINGSSDVEFLKQLRYQIVVEIIQATTISSFP
QLKRHKGKESAAMKADLLRARNMKRYINQLTVAKKQCEKRIRLLGGPAYDQQEDGALDEG
EGPQSQKILQFDDILANTLYREHFQMYMKRMDKTALINFWEAVEHLKNANKSEIPQLVGE
IYQKFFVESKEICVEKSLYKEIQQCLVGNKDIKVFCKIQEDVFEILKDRYYPAFIVSDLY
EKLVVKEEDKQDSQLISNKDEMGPGGEADEAAVEGTSEISEQTSFEVNKLRELNEKLEYK
RQALNSIQNAPKPDKKIVSKLKDEILLIEKERTDLQLHMARTDWWCENLGMWKASITSGE
VTEENGEQMPCYFVMVSLQEVRGIETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSL
SKLPFKSIDHKFMEKSKNQLNKFLQNILSDERLCQSEALYAFLSPSPDYLKVIDVQGKKN
SFSLSSFLEKLPRDFFSHQEEEPEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGM
FKWVRRTLIALVQVTFGRTINKQIRDTVNWIFSEQMLVYYISVFRDTFWPNGKLAPPTRI
TSKAQSQETKRRAQQKLLENIPDTLQSLLGQQNARHGIIKIFKALQETRANKHLLYVLME
LLLIELCPELRTHLDQLKGGQV
Download sequence
Identical sequences ENSCPOP00000009089 10141.ENSCPOP00000009089 ENSCPOP00000009089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]