SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009237 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009237
Domain Number 1 Region: 375-462
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000736
Family DEATH domain, DD 0.007
Further Details:      
 
Domain Number 2 Region: 30-77
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000254
Family TNF receptor-like 0.0029
Further Details:      
 
Domain Number 3 Region: 97-154
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000339
Family TNF receptor-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009237
Domain Number - Region: 559-615
Classification Level Classification E-value
Superfamily DEATH domain 0.0102
Family Caspase recruitment domain, CARD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009237   Gene: ENSCPOG00000010287   Transcript: ENSCPOT00000010381
Sequence length 620
Comment pep:known scaffold:cavPor3:scaffold_15:28629672:28664614:1 gene:ENSCPOG00000010287 transcript:ENSCPOT00000010381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFLCTSWAQPAQKVAGLVGTYRHVDRVTSQELTCDKCPAGTYVSEHCTNTSLRVCSSCP
AGTFTRHENGIEKCHDCSQPCPGLMVEKLPCSALTDRECTCPPGMFQFNATCAPHTVCPV
GWGVRKKGTENEDVRCKQCARGTFSDVPSSVLKCKYTDCLSHNLVVVTPGTRETDNVCGP
HPSPSSTTLASPDTTISSLFNPMESQEVPFSTYVPEGMNSTEPNSSASVRPKVPSGIQEG
TVPDNTSSAGGDQGVNKTLPSLRVVSRQQDAPHRHILKLLPSMEATGSERSSTPAKGAKR
GHPRQSPHKHFDINEHLPWMIVLFLLLVLVVIVVCSVRKSSRTLKKGPRQDPSTIVEKAG
LKKSLAPAPNREKWIYYCNGHGIDILKLVAAQVGSQWKDIYQFLCNASEREVAAFSNGYT
ADHERAYAALQHWTVRGPEASLAQLISALRQHRRNDVVEKIRGLMEDTTQLETDKLALPM
GPSPASPNPGPSGKLENATLLTVEPSPLDKNKGFFVDESEPLLRCDSTSSGSSALSRTGS
FITKEKKDTVLRQVRLDPCDLQPIFDDMLHILNPEELRVIEEIPQAEDKLDRLFEIIGVK
SQEASQTLLDSVYSHLPDLL
Download sequence
Identical sequences 10141.ENSCPOP00000009237 ENSCPOP00000009237 ENSCPOP00000009237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]