SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009295 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009295
Domain Number 1 Region: 263-350,555-592
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 8.77e-45
Family Inhibitor of apoptosis (IAP) repeat 0.00000221
Further Details:      
 
Domain Number 2 Region: 176-251
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.54e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000982
Further Details:      
 
Domain Number 3 Region: 39-138
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.79e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 453-549
Classification Level Classification E-value
Superfamily DEATH domain 2.31e-22
Family Caspase recruitment domain, CARD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009295   Gene: ENSCPOG00000010349   Transcript: ENSCPOT00000010443
Sequence length 617
Comment pep:known scaffold:cavPor3:scaffold_19:6477134:6500423:1 gene:ENSCPOG00000010349 transcript:ENSCPOT00000010443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKTTSQRFVQSPTYRKIENIMEESTVLPNRTNDNKQKMKYDFSCELYRMSTYSAFPSGV
PVSERSLARAGFYYTGVKDKVKCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLISAN
LQSISKNYSAVRNSSTHSVSPALEHCGSFSGFCSSLSPDPLNSRAIEDFSPTRTNSYSYA
MSTEEARFLTYKMWPLTFLSPLDLARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPTCPFLENSLETLRFSISNLSMQTHAARMRTFVYWPSTVPIQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLL
STSDTPGEENTDPPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRSLVKQTVQSKILTT
GENYKTVNDIVSELLNAEDERREEEKERQAEEMASDDLSLIRKNRMALFQRLTSVLPILD
SLLKANVINKQEHDVIKQKTQIPLQARELIDTILVKGNVAATIFKNCLKEIDSTLFENLF
VEKNMKYIPTDVSGLSLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRK
CPICRGIIKGTVRTFLS
Download sequence
Identical sequences ENSCPOP00000009295 10141.ENSCPOP00000009295 ENSCPOP00000009295 XP_003472807.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]