SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009402 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009402
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000016
Family Calponin-homology domain, CH-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009402   Gene: ENSCPOG00000010471   Transcript: ENSCPOT00000010565
Sequence length 959
Comment pep:known scaffold:cavPor3:scaffold_24:15719099:15806906:1 gene:ENSCPOG00000010471 transcript:ENSCPOT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNIILFLRGCKELGLKESQLFDPSDLQDTSSRVTVKNPDYTRKLKNVLVTIYWLGKAANS
CTSYSGTTLNLKEFEGLLAQMRKETDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRD
DSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGE
PKSAVPFNQYLPNKSNQTAYIPAPLRKKKTEREEYRKSWSTATSPLGGERPFRYGPRTPV
SDDAESTSMFDMRCEEEAAVLPHSRARQEQLQLINNQLREEDDKWQDDLARWKSRRRSAS
QDLIKKEEERKKMEKLLAGEDGRSERRKSIKTYREIVQEKERRERELHEAYKNARSQEEA
EGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLSDPSPMKYLRQQSLPPPKF
TATVETTIARASGGDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQEVLKTFKVDGK
VSLNGEAAHPAPAPGPALTKSQMFEGVARVHGSPVDVKQASNSVEINIKKPNSVPQELTA
TTEETELSTQEDENDGEEASKENAEPASSEESQHFTTTVTRCSPTVALVELSSPQVKNDV
LGEKDQKKPENEMSGKVELVLSQKVVKPKSPEPEATVMFPFLDKMPETNQLHLPNLNSQA
DSPNSEKSPLTTPFKFWAWDPEEERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKE
VEEEERRYYEEERKIIEDTVVPFTISSSSADQLSVSSSITESSGTANKPDLENSHPFQGN
DNDILHKTKESDLLEEKGSLSQGPWTPSENSAAKGIHQEHQLDTEVGAPPCGTDPQLAQD
PSQNQQVANPTMHVLEDVKPKTLPLNKTVNHHIESPSERRKSISGKKLCSSCGLPLGKGA
AMIIETLNLCFHIQCFRCGICKGQLGDAVSGTDVRIRNGLLNCNDCYMRSRSKSKKITP
Download sequence
Identical sequences 10141.ENSCPOP00000009402 ENSCPOP00000009402 ENSCPOP00000009402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]