SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009409 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009409
Domain Number 1 Region: 371-559
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.87e-66
Family Regulator of G-protein signaling, RGS 0.00000769
Further Details:      
 
Domain Number 2 Region: 768-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-64
Family DBL homology domain (DH-domain) 0.000000000816
Further Details:      
 
Domain Number 3 Region: 1001-1133
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-38
Family Pleckstrin-homology domain (PH domain) 0.00000131
Further Details:      
 
Domain Number 4 Region: 70-150
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009409   Gene: ENSCPOG00000010479   Transcript: ENSCPOT00000010573
Sequence length 1546
Comment pep:novel scaffold:cavPor3:scaffold_19:27724377:27812510:-1 gene:ENSCPOG00000010479 transcript:ENSCPOT00000010573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSWSRTEVSDFRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPSDSSSKKTKSSSE
ESRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNG
TLVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSAVGHVSPVMTSPHSP
GAPGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQSLQEDYNRTPAQRLLKEI
QEAKKHIPQLQEQLSKATGSAQDGAGVPPSRPSGDTLTVSEAEADPGDGLGKTDWNTGET
SRPSSDSADSPKSGLKEKVYPEENPERTEAVQDSDTQSFVGSPLTRVTPHIIGAEDDDFG
TEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETR
RIFLEFHQFFLDRSAHLKVSVPDEIAIDLEKRRPELIPEDLHRHYIQTMQERVHPDVQRH
LEDFRQKRSMGLTLAESELTKLDVERDKDRVTLEKERACAEQIVSKIEEVLMTAQAVEEE
KSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPS
ILGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLHQSGVTNEGTDAG
YLPSSSMSSVAAGVTLSQEGGKENDTGLKQVRETLASGDSLDGAPRTPNTIFDFPPPPLD
QVQEEEYEVERLTELGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLL
GLKACEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDIL
QLHVGLNEQMKAVRKRNETSVIDHIGEDLLSWFSGPGEEKLKHAAATFCSNQPFALEMIK
SRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTDWPTEREK
VKKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRK
MIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDKLVLRCHSKILASTADSKHTFSPV
IKLNTVLVRQVATADNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMATSVKEQS
TKPVIPLQSPPCEGDNDEEESPKVEHHGISVTNLQSPDRDLGLDSPLISSKPQTHSLSTS
EKSEAVDLFVAERQFAKEQHADGTLKEGGDSWHLSLTGEYLLIFENIYIYLLFKNLLVGL
LKQLLVQQLGLTEKSSQEDWRQFSRYRTAPQEAQADSGIQNSENTKVCHSAEGQVPFRTG
AGDSAGCNSSRTSTESSAPPDSVVLASQDSQTSNILVMDHMILTPEVSTTEPEGGLDESG
EHFFDACEAHSDDNPSEGDGAIKKEEKDVNLHISGNCLILDGYDTVQESSTDEEAASSFL
LQPVAGLPSMDSAYQEQYSPQSAHSDGAGSPFIPEFLLQRRWGAMEDSCFEIQTPSSCAD
SQSQIMEYIHKIEADLEHLKKVEESYTLLCQRLAGSALTDKHSDKS
Download sequence
Identical sequences ENSCPOP00000009409 ENSCPOP00000009409 10141.ENSCPOP00000009409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]