SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009495 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009495
Domain Number 1 Region: 169-360,459-607
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.18e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000835
Further Details:      
 
Domain Number 2 Region: 338-464
Classification Level Classification E-value
Superfamily GAD domain-like 6.7e-26
Family GAD domain 0.0023
Further Details:      
 
Domain Number 3 Region: 51-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.45e-22
Family Anticodon-binding domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009495   Gene: ENSCPOG00000010575   Transcript: ENSCPOT00000010670
Sequence length 655
Comment pep:known scaffold:cavPor3:scaffold_12:10045879:10070429:-1 gene:ENSCPOG00000010575 transcript:ENSCPOT00000010670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSSWLSQLCKSLSRPIGRTTQPIWVSLSRNLVLRSQRKIPEEFSSFVARTNTCGELRP
SHLGQEVTLCGWIQYRRQNVFLVLRDCHGLVQVIIPQDESAASVKKILCEAPLESVVQIS
GTVISRPPGQENPKMPTGAIEIKVKTAELLNSSKKLPFEIKDFVKKTEALRLQYRYLDLR
SAQMQYNLRLRSQMVMKMREYLCNLHGFVDVETPTLFKRTPGGAKEFLVPSREPGKFYSL
PQSPQQFKQLLMIGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIRNLIEG
LLQYSWPSDKDPVVIPFPSMTFAEALASYGTDKPDTRFGMKITDVSEVFRNTESEFLQDA
LSKPQGTIKAICVQEGAKHLKRKEIESIRKCATDHFNQEVLPIFLKANSNWNSRAARLLV
EEQRLELTRIMEAQEDDVVFLTAGEHGKTCSLLGKLRLECADLLEGRGVVLRDPTRFSFL
WVVDFPLFLPKEDNPSELESAHHPFTAPHPSDRHLLYTAPEKVRSQHYDLVLNGNEIGGG
SIRIHDAELQRYILSTLLKEDVTLLSHLLQALDYGAPPHGGIALGLDRLMCLVTGASSIR
DVIAFPKSFRGHDLMSNAPDSVPAEELKPYHIQVSWPTDSEAEKSSLNHSYHPES
Download sequence
Identical sequences 10141.ENSCPOP00000009495 ENSCPOP00000009495 ENSCPOP00000009495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]