SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009580 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009580
Domain Number 1 Region: 290-370
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-17
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009580   Gene: ENSCPOG00000010676   Transcript: ENSCPOT00000010773
Sequence length 376
Comment pep:novel scaffold:cavPor3:scaffold_32:16346180:16375935:-1 gene:ENSCPOG00000010676 transcript:ENSCPOT00000010773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWGPQKCLAKEIVNKGRRLWRVHFPVAGHYHWSKTHLGFVVRKEVTVEIGFCAWDHFLST
HNLQDTWMVAGPLFDIKAEQGTIAAVHLPHFVVVKGKHVDRSLFQVAHFKEKGMLLEKPT
SVETRCTVLENPNFSLMGVLLKVVPAAQSFIRIYSTTLLYHCIHAEEIKLHLYLIPSDCT
IQQAIDDEEKKFQFVRIHKPPPLSPLYVGTRYTVSGSETLEIMPQELELCYQRPGEHQHF
CEIYVGSLGSGIRLEMRNKQEGTVVWEALLKPGDLRPAVSPFPPPVIAFLHFVDQHREQL
VSRVTLVDSVLDKLLSGRVLSEEQYASVRAEVTKPDQMRQLFSFSPSWNSACKDKLYEAL
KEIHPHLIIHIQEKNM
Download sequence
Identical sequences ENSCPOP00000009580 10141.ENSCPOP00000009580 ENSCPOP00000009580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]