SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009726 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009726
Domain Number 1 Region: 8-163
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.66e-62
Family TRADD, N-terminal domain 0.000000362
Further Details:      
 
Domain Number 2 Region: 219-303
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000146
Family DEATH domain, DD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009726   Gene: ENSCPOG00000010831   Transcript: ENSCPOT00000010929
Sequence length 310
Comment pep:known scaffold:cavPor3:scaffold_22:9424729:9426641:1 gene:ENSCPOG00000010831 transcript:ENSCPOT00000010929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSNGHEERVGSAYLFLESSIDKVVLSDVYAHPQKKVAVYRALRTALAESSQGPDVLQ
ILKIHRSDPQLIMQLRFCGRQSCDRFLRAYREGALRATLQRCLAAALAQPSMLLQLELRA
GAEQLDAWLTDEEHCVQTILAQKPDRLRDEELTELEDALSSLMVGSAGQSVNTGVTPAPS
QSPAPSLLEEKPPPSTDQTFLFRGHPVVNRPLNLQDQQTFARSVGLKWRRVGRSLQRGCR
ALRDPVLDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLL
GLVDSNSGLV
Download sequence
Identical sequences H0VHT2
ENSCPOP00000009726 XP_005004714.1.53824 XP_013010283.1.53824 XP_013010284.1.53824 XP_013010285.1.53824 10141.ENSCPOP00000009726 ENSCPOP00000009726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]