SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009735 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009735
Domain Number 1 Region: 717-906
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-61
Family Nucleotide and nucleoside kinases 0.000000055
Further Details:      
 
Domain Number 2 Region: 560-674,711-745
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-30
Family SH3-domain 0.0000606
Further Details:      
 
Domain Number 3 Region: 463-553
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-29
Family PDZ domain 0.0000334
Further Details:      
 
Domain Number 4 Region: 206-312
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-28
Family PDZ domain 0.0000238
Further Details:      
 
Domain Number 5 Region: 314-406
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-26
Family PDZ domain 0.000044
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.37e-21
Family L27 domain 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009735   Gene: ENSCPOG00000010840   Transcript: ENSCPOT00000010939
Sequence length 909
Comment pep:novel scaffold:cavPor3:scaffold_7:59265256:59458879:1 gene:ENSCPOG00000010840 transcript:ENSCPOT00000010939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKQSEPVQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDIPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTETVPPSSPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAG
SIVHLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDIT
NCGARPLSGYMCNISLSSILFSSTAFDKKMLPVLSLNLGNCKIFREPRKVILHRGSTGLG
FNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQ
AVTIVAQYRPEAEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRTLYSRALFDYDKTK
DSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESEEVGVIPSKRRVEKKERARLK
TVKFNSKARGDKGEIPDDLGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTR
PVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQE
HKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSM
ENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPY
IWVPAKEKL
Download sequence
Identical sequences ENSCPOP00000009735 10141.ENSCPOP00000009735 ENSCPOP00000009735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]