SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009747 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009747
Domain Number 1 Region: 7-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-80
Family Protein kinases, catalytic subunit 0.00000419
Further Details:      
 
Domain Number 2 Region: 729-916
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.65e-50
Family Nucleotide and nucleoside kinases 0.0000000359
Further Details:      
 
Domain Number 3 Region: 601-719
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 468-568
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 336-387
Classification Level Classification E-value
Superfamily L27 domain 1.77e-19
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 397-448
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000394
Family L27 domain 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009747   Gene: ENSCPOG00000010851   Transcript: ENSCPOT00000010951
Sequence length 920
Comment pep:known scaffold:cavPor3:scaffold_33:16638182:17011577:1 gene:ENSCPOG00000010851 transcript:ENSCPOT00000010951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEK
DLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPDNNDAK
ELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVT
RVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVAN
QTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPS
TTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKN
GTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLV
TYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGK
NYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLR
TAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHL
EEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences A0A286XQM5
ENSCPOP00000009747 10141.ENSCPOP00000009747 ENSCPOP00000009747 XP_013007410.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]