SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009777 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009777
Domain Number 1 Region: 664-853
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-56
Family Nucleotide and nucleoside kinases 0.0000000952
Further Details:      
 
Domain Number 2 Region: 396-493
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 497-611,658-692
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 68-171
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 175-269
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-27
Family PDZ domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009777   Gene: ENSCPOG00000010885   Transcript: ENSCPOT00000010985
Sequence length 856
Comment pep:known scaffold:cavPor3:scaffold_40:9218182:10146160:1 gene:ENSCPOG00000010885 transcript:ENSCPOT00000010985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQIENIHGYIYESTIKTVFASPAPI
IVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIP
GGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEI
KLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLE
EVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLE
YKTSLPPISPGRYSPIPKHMLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFL
LSAPYPHYHLGLLPDSEMTSHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFN
IVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTV
TIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSG
LPSQGLSFKYGDILHVINASDDEWWQARRVTLEGDSEEMGVIPSKRRVERKERARLKTVK
FNAKPGVIDSKGSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTR
QEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQ
MEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAI
FIKPKSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVI
EEQSGPFIWIPSKEKL
Download sequence
Identical sequences 10141.ENSCPOP00000009777 ENSCPOP00000009777 ENSCPOP00000009777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]