SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009819 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009819
Domain Number 1 Region: 410-518
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 169-271
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-19
Family PDZ domain 0.026
Further Details:      
 
Domain Number 3 Region: 694-804
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 4 Region: 17-113
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000723
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 5 Region: 519-591
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000512
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009819   Gene: ENSCPOG00000010928   Transcript: ENSCPOT00000011029
Sequence length 1770
Comment pep:known scaffold:cavPor3:scaffold_10:47890838:47951284:1 gene:ENSCPOG00000010928 transcript:ENSCPOT00000011029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVRIKLYQSTTMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQTEKTKIRLIKRIKNSEVEHAFAVQQLRKSGKNAKITIRRKKKVQLPISRP
DPEPVSDNEEDSYDEEVHDPRSSRGLANRRNEKSWARDRSASRERSLSPRSDRRSVTSSQ
PAKPTRVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSREEERISKPGAVSTPVKHID
DHTPKTIEEVTVERNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNSLYRAEQLASVQYTLPKTAGGD
RADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVA
REKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLN
YAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNS
MNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDS
RHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSTGMHHENQTYPS
YSPQAQPQPIHRIDSPGFKTASQQKAEASSPVPYLSPETNPASSTSAVNHTVNLTNVRLE
EPTPAPSSSHSPQADPLRTPSAEAAHTMLRDQEPSLSSHVDPAKVYRKDPYPEEMRQNHV
LKQPAIGHPGQRPDRESNLTYEPQLPYVEKQPSRDLEQPSYRYDSSSYTDQFSRSYDHRL
RYEDRIPPYEEQWSYYDDKQSYQPRPSFDNQHSRDMDSRQHPEESTERGYFPRFEDPASL
SYDNRPRYEQPPRASTLRHEEQLTSGYDVHSRYRPEAQPYPPAGPKSSDPKQYFDQYPRN
YEQAPPQGFTSKGGHYEPLHGAAVVPPLVPSSQHKPEVLPPATKPLPPPPALTEEEEDPA
MKPQSVLTRVKMFENKRSASLENKKDVNDTASFKPPEVASKPPGAAVTGPRPTPQNQFSE
HDKTLYRIPEPQKPQPKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIPAS
HHSEPAKPVHSQNQSNFPNYSAKGKPEADAGDRSFGEKRYDPIQATPPPPPLPSQYTQAP
QPISSSSVHLHAKGAHGEGNSVSLEFQNSLLSKPDPPPSQSKPPTFRAPNREDTAQTTFF
PQKSFPDKAPVNGAEQTQKTITPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVH
NKPDLSSKAPTSPKTLMKAHSSAQPPEFDSGVETFSIHADKPKYQVNNIGTVPKAVPVSP
SAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRD
NSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSG
DPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences 10141.ENSCPOP00000009819 ENSCPOP00000009819 ENSCPOP00000009819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]