SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009825 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009825
Domain Number 1 Region: 23-292
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2204-2324
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-38
Family Pleckstrin-homology domain (PH domain) 0.00000201
Further Details:      
 
Domain Number 3 Region: 308-429
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 616-755
Classification Level Classification E-value
Superfamily Spectrin repeat 6.96e-32
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 1024-1179
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 6 Region: 1236-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 1872-2026
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1552-1707
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 9 Region: 825-964
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 438-541
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1712-1817
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 542-650
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 759-859
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-20
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 14 Region: 1397-1495
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-17
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 15 Region: 2007-2092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009825
Domain Number - Region: 1182-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0124
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009825   Gene: ENSCPOG00000010934   Transcript: ENSCPOT00000011035
Sequence length 2377
Comment pep:known scaffold:cavPor3:scaffold_162:238320:371986:-1 gene:ENSCPOG00000010934 transcript:ENSCPOT00000011035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGADVEEELRRFKMTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKA
LADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGR
MRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETE
DNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKK
SNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEG
KRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTY
RTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERE
LALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAI
ETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMN
LGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGV
NASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEM
AEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE
EHFGSEKIRERIVYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIV
SSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDSLHEQAGALPQEHAESPDVRGRLSGI
EERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVI
QHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRK
KDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVA
IEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQF
LRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEM
VTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNN
QEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQ
EKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEAR
NLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLES
TTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLEN
QMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEI
HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFER
SQNIVTDSSSLNAEAIRQRLTDLKQLWGLLMEETEQRHRRLQEAHEAQQYYFDAAEAEAW
MSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESE
RISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELG
QDYEHVTMLQERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAW
ADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHT
TFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRL
VDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSF
TTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDAS
VAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEV
RRQQEEEERKRQPPSPEPSTKVSEETESQQQWDTSKGEQVSQNGLPTEQGSPRMAETVDT
SEMVNGAAEQRTSSKESSPIPSPTSDRKAMTALPAQSAATLPARTQETPAAQMEGFLNRK
HEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALD
YKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHDTSASTQSTPASSRAQ
TLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences 10141.ENSCPOP00000009825 ENSCPOP00000009825 ENSCPOP00000009825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]