SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010016 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010016
Domain Number 1 Region: 405-490
Classification Level Classification E-value
Superfamily DEATH domain 1.06e-18
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010016   Gene: ENSCPOG00000011138   Transcript: ENSCPOT00000011242
Sequence length 518
Comment pep:known scaffold:cavPor3:scaffold_15:32654457:32659711:1 gene:ENSCPOG00000011138 transcript:ENSCPOT00000011242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPPESALQSPQFLLLVGIPVVSTLLLVQCLRWHCPRWLLGPCWKPDSHEEPEPPSSPPP
EFEVPGHCVPATLPEIAAFYQELHTPTQGHTVTRQLMNKLLVFSAREVDHRGGCLLLQDT
GISLLIPPGAVALGRQERVSLILVWDLSDAPLLSRTQGLVSPVVACGPHGASFLKPCTLT
FKHCAQQPGHARTYSSNTSLLDAKAWRPLGQPGAHTSLDECRIQLSHFSLYTCVLEAPVG
QAARKWLQLAIFCSPLAPGQTHLQLRVYFLNNTPCALQWAVTNEQPHGGRLRGPCQLFDF
TGARGDQCLKLKYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAANENEDCSAL
TNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPSCNRLPPELFEQLRMLL
EPHSITGNDWRRLASHLGLCAMKIRYLSCQRSPAAAILELFEEQNGSLLELHCLMTSMER
LDCASVIQSYLSTTPHSSPAVVHNHVWENQHLELDEKL
Download sequence
Identical sequences H0VII3
ENSCPOP00000010016 XP_003473928.1.53824 XP_013012111.1.53824 XP_013012112.1.53824 ENSCPOP00000010016 10141.ENSCPOP00000010016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]