SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010042 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010042
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-46
Family Regulator of G-protein signaling, RGS 0.00000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010042   Gene: ENSCPOG00000011168   Transcript: ENSCPOT00000011272
Sequence length 181
Comment pep:known scaffold:cavPor3:scaffold_39:633955:689233:-1 gene:ENSCPOG00000011168 transcript:ENSCPOT00000011272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKIQKPSADEALQ
WRDSLDKVLQNSYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKEIYEEF
IQTEAPKEVNIDHFTKDVTMKNLMEPSLNSFDMAQKRIHALMEKDSLPRFVRSEFYQELV
K
Download sequence
Identical sequences A0A286Y1Q3
XP_003468708.2.53824 ENSCPOP00000010042 10141.ENSCPOP00000010042 ENSCPOP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]