SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010115 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010115
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.83e-41
Family Regulator of G-protein signaling, RGS 0.000000106
Further Details:      
 
Domain Number 2 Region: 782-863
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-26
Family DIX domain 0.00000966
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010115
Domain Number - Region: 706-733
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010115   Gene: ENSCPOG00000011250   Transcript: ENSCPOT00000011356
Sequence length 863
Comment pep:known scaffold:cavPor3:scaffold_4:20275196:20321934:-1 gene:ENSCPOG00000011250 transcript:ENSCPOT00000011356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTEPRPISHSFCPGKVAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLQQEGCADLLDFWFA
CSGFRKLEPCGSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVVKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDAEEDNGRDSGAPSRLTQKLLLETATTRASSSRRYSEGREFRCGPWREP
ANPYYISSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGVPPYRTRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDLPSGLPGVSHKLPSASAWHHFPPRCVDMGCTGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSGHVAKIAMLGGTASGHGKHMPKSGTKLDATGLHHHRHIHHHVHH
STARPKEQLEAEATRRVQSMWGLESHNHSAKPRGYSENTGATPSTSDPSYSGKAGGPSKR
NAKKADCGKTTNTEVPGATEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGARKQQAHEN
SRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEK
RASKLSSKQRYVQAVMQRGRACVRPACTPMLSVVPAVSDLELSETEMKSQRKMGSGSAQP
CDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEE
VREDQAVLPVFEEKIIGKVEKVD
Download sequence
Identical sequences H0VIR5
ENSCPOP00000010115 10141.ENSCPOP00000010115 ENSCPOP00000010115 XP_003478119.2.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]