SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010134 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010134
Domain Number 1 Region: 206-285
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000606
Family DEATH domain, DD 0.02
Further Details:      
 
Domain Number 2 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000322
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000158
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number 4 Region: 290-370
Classification Level Classification E-value
Superfamily DEATH domain 0.00000089
Family DEATH domain, DD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010134   Gene: ENSCPOG00000011271   Transcript: ENSCPOT00000011377
Sequence length 400
Comment pep:known scaffold:cavPor3:scaffold_0:6793392:6820030:1 gene:ENSCPOG00000011271 transcript:ENSCPOT00000011377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRALCCALLFLDLSIKWTTQETFPPKYLHHDPETSRPLMCDKCPPGTYLKQHCTARRKT
VCAPCPDHYYTDSWHKSDECLYCSPVCKELQYVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGFGVLQAGTPERNTVCRRCPDGFFSDETSSKAPCRKHTNCSAFGLLLTQKGNST
HDNICSANSDTQTCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIK
RRHSSQEQTFQLLKLWKQQNKEQDVVKKIIQDIDLCENGVQRHIGHANLTYEQLRSLMES
LPGKKVGIEDIERTRKTCRSSEELPKLLSLWRMRNGDQDTLKGLMHALKHLKTYHFPKTV
THSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences H0VIT1
ENSCPOP00000010134 10141.ENSCPOP00000010134 ENSCPOP00000010134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]