SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010151 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010151
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-31
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010151   Gene: ENSCPOG00000011290   Transcript: ENSCPOT00000011396
Sequence length 206
Comment pep:known scaffold:cavPor3:scaffold_42:9877066:9880949:1 gene:ENSCPOG00000011290 transcript:ENSCPOT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLVLLHSLSTRLSDRELTELKFLCRNRVSKRKLELMESGLDLFNVLLEQNDLDAERT
DLLRQLLTSLRRQDLLQCLDSFEVEATAGASLRETDLRTAFDIICDNVGRDWKRLARQLN
ISDTKIDAIEERYPRNLPERVRESLRIWGNLQKENATVARLVQVLRDCRMNLVADLVEEE
QQARESQNESKSMSSMAWESEASSSQ
Download sequence
Identical sequences H0VIU7
ENSCPOP00000010151 ENSCPOP00000010151 XP_003468372.1.53824 10141.ENSCPOP00000010151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]