SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010192 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010192
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily GLA-domain 1.43e-21
Family GLA-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010192   Gene: ENSCPOG00000011336   Transcript: ENSCPOT00000011442
Sequence length 231
Comment pep:known scaffold:cavPor3:scaffold_213:663650:664684:1 gene:ENSCPOG00000011336 transcript:ENSCPOT00000011442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVFLEARNAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFW
KGYPNAVYSVRDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRY
LASRAGHSLPRVMVYRGTMHSQGESSGHREAGSTPQVMLGPSRGSRATIRLESTLYLPEL
SLTRLSSATPPPSYEEVTAPQEGSSEEASVSYSDPPPKYEEIVAASPGADK
Download sequence
Identical sequences ENSCPOP00000010192 10141.ENSCPOP00000010192 ENSCPOP00000010192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]