SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010302 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010302
Domain Number 1 Region: 295-413
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-40
Family Regulator of G-protein signaling, RGS 0.0000057
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-24
Family DEP domain 0.005
Further Details:      
 
Domain Number 3 Region: 225-284
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000144
Family Transducin (heterotrimeric G protein), gamma chain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010302   Gene: ENSCPOG00000011460   Transcript: ENSCPOT00000011566
Sequence length 413
Comment pep:novel scaffold:cavPor3:scaffold_4:20259577:20266326:-1 gene:ENSCPOG00000011460 transcript:ENSCPOT00000011566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMERVVVSMQDPDQGVRMRSQRLLITVISHAVTGGDVVEWLAQKFCISEPTEALHLGDLL
AQHGYLYPLREPHSLALRPDETPYRFQTPYFWTSTLWPAAELDYAIYLTKKNIRKQGALL
EHEKEHYDQLHKKINHTWDLVVMQAREQLRAAKQRRKGDRLVIACQEQTYWLVNRPPPGA
PNVLEQGPERGSCTGSRVQMRERKFNLQYRCLAELPENLQMEASKSPGSDFYKREIEFSR
KALGRTRVKSSICLEAYLKFSSQHSLHDPILSGCLPSNPWITDDDSYWTINAPIWAFSFQ
ELLDDPVGRTHFMDFLQTEFSAENLSFWEACEELRFGGQAQIPDLVDAVYQQFLAPGAAR
WVNIDSRTMERTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKGLL
Download sequence
Identical sequences ENSCPOP00000010302 ENSCPOP00000010302 10141.ENSCPOP00000010302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]