SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010307 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010307
Domain Number 1 Region: 61-280,443-462
Classification Level Classification E-value
Superfamily L domain-like 1.13e-40
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 641-756
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-29
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010307   Gene: ENSCPOG00000011465   Transcript: ENSCPOT00000011571
Sequence length 764
Comment pep:known scaffold:cavPor3:scaffold_7:60466819:60550492:1 gene:ENSCPOG00000011465 transcript:ENSCPOT00000011571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGLAAVAATAEYSGPVASAGHLSVINGGLNAGAGPSPGPGSWSRSLDRALEEAAVTG
VLSLSGRKLREFPRGAAHHDLTDTTRADLSRNRLSEVPIEACHFVSLENLNLYQNCIRYI
PEAILNLQALTFLNISRNQLSTLPVHLCNLPLKVLIASNNKLVSLPEEIGCLRHLTELDV
SCNEIQTVPSQIGNLETLRDLNIRRNHLVHLPEELAELPLIRLDFSCNKITAIPVCYRNL
RHLQVITLDNNPLQSPPAQICIKGKIHIFKYLNMQACKIAPDLPDYDRRPLGFGSCHEEL
YSGRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEITKEQRLRRESQYQESRNS
LVVTNGGVEHDLDQIDYIDSCAAEEEEDEARQPRGRDSNSLSSQFMAYIEQRRVSHEGSP
VKPVAIRVFQKPEDMRRYSHQNRIPVEPPSLLSLSPSHNQLPHTDLESHRRREQLIERTR
REAQLAALQYEEEKVRTKQIQREAVLDFIKVRQLNSLLHFSPPLQCPFPPRRSQHTDDSA
LLVSLSGLNQVGCAATLPHSAAFMPLKVSLAFNLILLFPADLVHHSAAYSFPAAIQRNQP
PRPESFLFRGAVRAETNKDQTSSLLTSLAPATDPTECITRQREEELKLIDQLRKHIEYRL
KVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTIAKCRRNVENFLEACR
KIGVPQEQLCLPLHILEEKGLGQVAVTVQALLALAPPKQQQPQQ
Download sequence
Identical sequences ENSCPOP00000010307 10141.ENSCPOP00000010307 ENSCPOP00000010307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]