SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010362 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000010362
Domain Number - Region: 8-85
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 202-257
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0952
Family DNA-binding N-terminal domain of transcription activators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010362   Gene: ENSCPOG00000011520   Transcript: ENSCPOT00000011629
Sequence length 280
Comment pep:known scaffold:cavPor3:scaffold_1:34102356:34106328:1 gene:ENSCPOG00000011520 transcript:ENSCPOT00000011629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQDISTQKIEDLMDIVKKLQKVDSLEPRIEFLINRINEVQQAKKKVTEDLGKVQFVWDAL
QEELDSLHEEKAHLKEILNKKQENLRILQLHCQEKESEAQRKQTLLQECKERIASLNLQI
EEEKNKQRQLRLDFEDQLEALMDQHKDLWEFHKPEQLSREICALDSNKEQLLKEEKLVEV
KLEDVKHQLCLLGGPEGSSTFRDSSLRSQEAAAAVQLFKEENKKAEEFLEAAAQHHQQLK
QRCQQLQEKRQRLKEELEEFVIHAQSMQVEGTGLQRVVSP
Download sequence
Identical sequences 10141.ENSCPOP00000010362 ENSCPOP00000010362 ENSCPOP00000010362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]