SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010424 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010424
Domain Number 1 Region: 216-331
Classification Level Classification E-value
Superfamily DEATH domain 5.36e-27
Family DEATH domain, DD 0.0000684
Further Details:      
 
Domain Number 2 Region: 48-104
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000212
Family TNF receptor-like 0.0034
Further Details:      
 
Domain Number 3 Region: 106-150
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000648
Family TNF receptor-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010424   Gene: ENSCPOG00000011587   Transcript: ENSCPOT00000011699
Sequence length 333
Comment pep:novel scaffold:cavPor3:scaffold_15:1552625:1564346:1 gene:ENSCPOG00000011587 transcript:ENSCPOT00000011699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIFSWTLIPQVFTFIPGPLSKTANARGIDTSSEGLKLKREITKTETQCTEDRHPVGQFCC
RLCPPGTKKAADCTSDENETHCVPCKEGNEYTDKQHYSSQCRRCTFCDAGHGLEVERNCT
RTQDTKCRCKSNFYCSSPVCEHCDPCIRCEHGIIEECTPTSNTKCKEESSSANLLWLLLL
LPFGGLVLGQLLYKYCKKQPRGNQNLNDKRTLLNHAIFYFSDVEFSKHIPKITEIMTINE
VREFVRKNGVPEAKIDDIKNDNQQDTGEQKVQLLRSWYQLNGKKNACQIFIKSLEEDNFK
AYSQKVQDIFWADVRSNQENSNSTSENERQSLA
Download sequence
Identical sequences ENSCPOP00000010424 10141.ENSCPOP00000010424 ENSCPOP00000010424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]