SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010433 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010433
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.06e-46
Family Regulator of G-protein signaling, RGS 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010433   Gene: ENSCPOG00000011598   Transcript: ENSCPOT00000011710
Sequence length 211
Comment pep:known scaffold:cavPor3:scaffold_12:28710133:28712778:-1 gene:ENSCPOG00000011598 transcript:ENSCPOT00000011710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMFLAVQHDCVPMDKSAGSGSKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPAKPKT
SKKSKQQTFIKPSPEEALLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQINTEPHAT
Download sequence
Identical sequences A0A286X7Q8
XP_003474906.1.53824 ENSCPOP00000010433 10141.ENSCPOP00000010433 ENSCPOP00000010433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]