SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010610 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010610
Domain Number 1 Region: 13-99
Classification Level Classification E-value
Superfamily DEATH domain 4.52e-16
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010610   Gene: ENSCPOG00000011796   Transcript: ENSCPOT00000011911
Sequence length 230
Comment pep:known scaffold:cavPor3:scaffold_2:51076785:51085673:1 gene:ENSCPOG00000011796 transcript:ENSCPOT00000011911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKLIAERHFDHLRVSREDTEEISCRTSSRKR
AGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEYLRGLKSNSCEP
FPDGATNNLSRSNSNESNFSEKLRASTVMFHPEGESSTAPFFSPVSSLNLPVLEVGRTEN
TIFSSSSALPRPGDPGAPPLPPELQLEEGGTCGNSSEMFLPLRSRALSPQ
Download sequence
Identical sequences ENSCPOP00000010610 ENSCPOP00000010610 10141.ENSCPOP00000010610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]