SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010637 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010637
Domain Number 1 Region: 114-377
Classification Level Classification E-value
Superfamily Caspase-like 3.14e-77
Family Caspase catalytic domain 0.000000147
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000412
Family Caspase recruitment domain, CARD 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010637   Gene: ENSCPOG00000011825   Transcript: ENSCPOT00000011940
Sequence length 378
Comment pep:known scaffold:cavPor3:scaffold_19:8889466:8902529:-1 gene:ENSCPOG00000011825 transcript:ENSCPOT00000011940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTEKHQIKPPLKMLEHIGKEYLTGILEDMVQKNVVKLDEEAKKRFTEAERRDKARVFVD
SVRRKPKEAGQAFLQTFFNLDKETNGTRVPQDNECRAIESSETTDTLKTCPPEEFQKLCI
ERASEIYPIKNRNERTRQALIICNVEFSHLTVRNGAEQDVTGMKQLLEELDYTVTVKENL
TARDMEYALSEFAGKPEHKSSDSTFLVLMSHGILHGICGTLHSDDSPDVLQYDTIFKIFN
NRSCPGLRDKPKVIIVQACRGVYPEGMWVRDSPAALEDSLAQSSENLESDAVYMTHVEKD
FIIFYSTTPHNISWRDSTKGSYFITQLITGFQKYAWCDPLQEIFRKVQLSCEKPNGIAQM
PTIGRSTVGRLFYLFPGH
Download sequence
Identical sequences 10141.ENSCPOP00000010637 ENSCPOP00000010637 ENSCPOP00000010637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]