SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010670 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010670
Domain Number 1 Region: 343-427
Classification Level Classification E-value
Superfamily DEATH domain 0.000000883
Family DEATH domain, DD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010670   Gene: ENSCPOG00000011862   Transcript: ENSCPOT00000011977
Sequence length 447
Comment pep:known scaffold:cavPor3:scaffold_24:9946058:9958723:-1 gene:ENSCPOG00000011862 transcript:ENSCPOT00000011977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHSRWTPWLPVLVVSVVWSASAEYSSCGEDEFYNQTTGLCQLCPPCGPGEEPYMSCGYG
TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYML
ENRPRNIYGMVCYSCLLAPPNTKECAGVSSGVSANSPRTSGGSTLPPSQHAHKAELSGQG
HLATALIIAMSTIFIMAVAIVLIIMFYIMKTRPSAPAACCSSPPGKSVDAPVSQGVEKKE
APDGVVIFSEKDEFEKLTATPAKTTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPELC
LLSLVHLSREKPAPSSKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRMLS
STYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIERL
DAVESLCADIVEWAGVAPPASPPPAAA
Download sequence
Identical sequences 10141.ENSCPOP00000010670 ENSCPOP00000010670 ENSCPOP00000010670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]