SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010828 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010828
Domain Number 1 Region: 248-600
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.79e-116
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000183
Further Details:      
 
Domain Number 2 Region: 97-240
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.4e-36
Family Anticodon-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010828   Gene: ENSCPOG00000012036   Transcript: ENSCPOT00000012152
Sequence length 623
Comment pep:known scaffold:cavPor3:scaffold_22:1724071:1737906:1 gene:ENSCPOG00000012036 transcript:ENSCPOT00000012152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRAALRLVRGSVCHTWAEWGQRELRLGQLAPFTTLHKDKPLSDKRSELKRRLKAEKKV
AEKEAKQKELSEKQLSQTAAATNHTTDNGVGAEEESLDPNQYYKIRSQAVHQLKVSGEDP
YPHKFHVDISLTHFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKL
QVMANSRNYKSEEEFIRINNKLRRGDIIGVQGNPGKTKKGELSIIPFEITLLSPCLHMLP
HLHFGLKDKETRYRQRYLDLMLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII
PGGAVARPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPE
FTTCEFYMAYADYHDLMEITEKLISGMVKSITGSYKVTYHPDGPEGQAYEIDFTPPFRRI
SMVEELEKALGVKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEV
TCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEE
QAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVTMFLTDSNNIKEVLLFPAMK
PEDKKETVANTDPVENTSIGTSV
Download sequence
Identical sequences H0VKJ2
XP_003472030.1.53824 10141.ENSCPOP00000010828 ENSCPOP00000010828 ENSCPOP00000010828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]