SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010841 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010841
Domain Number 1 Region: 183-453
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-88
Family Caspase catalytic domain 0.000000000854
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily DEATH domain 3.2e-28
Family Caspase recruitment domain, CARD 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010841   Gene: ENSCPOG00000012051   Transcript: ENSCPOT00000012167
Sequence length 455
Comment pep:known scaffold:cavPor3:scaffold_25:18322160:18338418:1 gene:ENSCPOG00000012051 transcript:ENSCPOT00000012167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQLLRRCRLRLVGDLQVTPLWDALLKRELFTPDMIDDIQQAGSRRDQARQLITDL
ETRGRQALPLFICCLEETGQDTLASLLRTSRQVTKRDPEAIRPLDLEPAVVGPMGLKPEK
PRVMKPDPSNLAPGNVTPVVLGPEELLPAQLRPEVLRPEAPRPVDIGSEGLGHPEGDLCL
PGVCPSHQPGVYVLDADPCGHCLIINNVNFCPASELGTRTGSNIDCEKMRRRFCQLHFHV
TVRGDLTAKEMLQALAELARQDHQALDCCVVIILSHGCQASHLQFPGAVYGTDGCPVSVE
RIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVACMSPDDEGPGSSPEADAVPFQG
DLEPLDQPDAVSSLPTPSDILVSYSTFPGFVSWRNTERGSWYIETLDSILEHWASSEDLQ
YLLLRVANAVSEKGIYKQIPGCFNFLRKKLFFKTK
Download sequence
Identical sequences 10141.ENSCPOP00000010841 ENSCPOP00000010841 ENSCPOP00000010841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]