SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010844 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000010844
Domain Number - Region: 44-92
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000536
Family TNF receptor-like 0.014
Further Details:      
 
Domain Number - Region: 88-139
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0112
Family TNF receptor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010844   Gene: ENSCPOG00000012054   Transcript: ENSCPOT00000012170
Sequence length 404
Comment pep:known scaffold:cavPor3:scaffold_6:26433580:26499625:1 gene:ENSCPOG00000012054 transcript:ENSCPOT00000012170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFKVLQEQEKTFFTILLLLGYLPCTVISETGDCRQQEFRDGSGNCVLCKPCGPGMELSK
ECGFGYGEDAQCVTCRPHRFKEDWGFQKCKPCLDCVLLNRFQKANCSVTGDAVCGDCLPG
FYRKTKLVGFQDMECVPCGDPPPPYEPHCTSKVNLVKIASTASSPRDTALAAVICSALAT
VLLALLILCVIYCKRQFMEKKPSWSLRSEDIQYNSSELSCFDRPRLSEYAHRACCQCHQD
SAQTYGPVHVTPPLCCEGTCGSDQPALGCGVHSAATLQERNTVLGGMSVPAVFMSLTHSG
CGEFSDACPLMQNAMGGDDISFCDAYPELTGEDIISLGPEDESSASLDSNNSQGLTCGAV
SVQAHPANFTETAGFCGHSSTATEPALAPDAPPPRSQLDPVPGS
Download sequence
Identical sequences ENSCPOP00000010844 10141.ENSCPOP00000010844 ENSCPOP00000010844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]