SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010877 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010877
Domain Number 1 Region: 33-94
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000565
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 185-228
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 88-153
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family Fibronectin type I module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010877   Gene: ENSCPOG00000012095   Transcript: ENSCPOT00000012211
Sequence length 336
Comment pep:novel scaffold:cavPor3:scaffold_0:6427567:6433406:-1 gene:ENSCPOG00000012095 transcript:ENSCPOT00000012211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGERSMSLPLQKRCLCVAFLTLQLLGQVARTALGARGDRSSSCPVCARQRGESCSELAP
CDGSGGLYCDRSADPSNQTGICMVLDGDNCVFDGVIYRSGEKFEPNCQYHCTCRDGQIGC
VPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGPHEEGLTSLALPAYRPEATVGVEVSD
SSVNCIEQTTEWSACSRSCGMGFSTRVTNRNRQCDMVKQTRLCMVRPCEPEPEQPAEKKG
KKCLRTQKSLQAVHLQYENCTSLLAYKPRFCGVCSDGRCCTPHNTKTVQVEFQCSPGQTV
KKPVMVISTCTCHTNCPKNNEAFLQDLEPKSSTGEI
Download sequence
Identical sequences ENSCPOP00000010877 10141.ENSCPOP00000010877 ENSCPOP00000010877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]